Home Page Properties For Sale Rentals Add your Listing All The Articles
Login Estaplace Contacts About Us House Exchange Real Estate Forum
ESTAPLACE.COM REAL ESTATE - FREE LISTING SERVICE - is an accommodation and real estate directory, where real estate property owners or real estate agencies connect with vacationers and home buyers worldwide. If you are a seller, you can add listings in few seconds, and if you are a buyer you can search listings to find your dream property!
Search by keywords or by a location.

You can also browse our web directory.


Search on 41276 Newsgroup messages
alt.building.construction (6030)alt.building.realestate (263)alt.real-estate-agents (944)
alt.real-estate.commercial.ga (8)alt.realtor.relocation (120)at.anzeigen.wohnen (408)
be.immo (195)biz.marketplace.real-estate (101)dc.housing (30)
de.markt.wohnen (260)de.rec.reisen.misc (9023)fl.real-estate (15)
fr.misc.droit.immobilier (22012)fr.petites-annonces.immobilier (7682)free.it.annunci.immobiliari.bologna (1207)
free.it.turismo.scambiocasa (191)free.it.vacanze.brasile (1176)free.it.viaggi.offerte (599)
free.it.viaggi.usa (6269)it.annunci.immobiliari (46564)kw.housing (290)
misc.consumers.house (3556)misc.invest.real-estate (3375)ne.housing (63)
nj.market.housing (65)nyc.market.housing (56)ott.housing (6237)
pdaxs.ads.real_estate (81)phl.housing (209)pt.mercado.imobiliario (1970)
realtynet.canada-intl (62)realtynet.commercial (99)realtynet.residential (194)
rec.travel.caribbean (2747)rec.travel.europe (80006)relcom.commerce.estate (1616)
sdnet.housing (16)seattle.forsale.housing (224)slo.housing (2)
tnn.real-estate (21)tor.housing (757)
[ 25 Jul 2004 21:02:34 -0700 ] [ 3729 ] [ realtynet.residential ] [ view full article ]
loanoriginator24@juno.com (Candice) - Electronic Loan Origination - Real Estate Agents: I can originate your loans for you electronically. E-mail me for more information. . ...
[ 25 Jul 2004 17:09:34 -0700 ] [ 3728 ] [ realtynet.residential ] [ view full article ]
vegascomplete@aol.com (David Heinz) - Las Vegas 57,000 3 bedroom 2 bath house - email vegascomplete@aol.com for more information . ...
[ 23 Jul 2004 14:15:35 -0700 ] [ 3722 ] [ realtynet.residential ] [ view full article ]
pzion@yahoo.com (pzion) - Lakefront Vermont Home - House + 3 acres for sale on Lake Dunmore in Vermont's Green Mountains. Great location, also close to hiking on state land and skiing in winter. House is all year round with oil-fired baseboard hot water. Four bedrooms, two bathrooms, two sliding doors to deck, new appliances, including washer & dryer. There's an attic and a basement. Too many amenities to list. Dock and motorb...
[ 21 Jul 2004 21:57:50 -0700 ] [ 3717 ] [ realtynet.residential ] [ view full article ]
joebous@yahoo.com (Joe Bous) - SEEKING BROKER PARTNERSHIP - SEEKING BROKER PARTNERSHIP We have developed a sophisticated MLS management tool for a web site. We are seeking to partner with a Broker and Multiple Agents in the DC/VA/MD area. We will generate all the leads. The broker and agents will faciliate the leads will collect the commission from all sales that are generated through our system. Please contact me if you are interested in...
[ Thu, 22 Jul 2004 01:10:27 GMT ] [ 3716 ] [ realtynet.residential ] [ view full article ]
davidgrey@yahoo.com - WhoreCam 696 - I hired a prostitute and recorded her with my cam. Enjoy these gr8 pics of her skanky big titties zymwqpfgeefljtitqgwylurqoiwbunlzezsjtogilzujlvuclptrmdggvfxrinvrntzxvygsygjqsr ...
[ Wed, 14 Jul 2004 09:06:26 -0500 ] [ 3708 ] [ realtynet.residential ] [ view full article ]
"Jason Danner" - Automated Website and Earn Commissions ASAP!! - ...
[ Mon, 12 Jul 2004 00:51:26 -0500 ] [ 3703 ] [ realtynet.residential ] [ view full article ]
"Jason Danner" - Automated Website and Earn Commissions ASAP!! - Give Away FREE INSTALLATION OF SATELLITE SYSTEMS... A Business that WORKS!! Learn how to make $1000's giving away FREE SATELLITE SYSTEM INSTALLATIONS! FREE Automated Website and Earn Commissions ASAP!! https://www.vmcsatellite.com/channels/order.cfm?aid=89022 . ...
[ 11 Jul 2004 13:05:50 -0700 ] [ 3702 ] [ realtynet.residential ] [ view full article ]
mprimo@realtyrators.com (Realtyrator.com) - You may like the idae behind this site www.realtyrators.com - The concepts and beliefs behind Realtyrators.com are simple... Buying and Selling a home is one of the biggest and most important investments one can make. Through our extensive research we found that a free resource was needed to help home buyers and sellers find a Real Estate Agent that have been rated by felow consumers Our Ratings of agents are based on the opinions...
[ Sun, 11 Jul 2004 12:23:02 -0600 ] [ 3701 ] [ realtynet.residential ] [ view full article ]
"Foo" - 6 bedroom home for sale in Idaho - 6 Bedroom, 3 bath home in Ammon, Idaho 2,900 Square Foot home on 1/4 of an acre. Large deck in backyard with fenced yard. Wired and designed for Home Theatre in basement. Central A/C and Gas heat. Mature yard with shrubs and trees. To view pictures and more info visit: www.reachbuyers.com . ...
[ Tue, 6 Jul 2004 17:38:54 -0500 ] [ 3698 ] [ realtynet.residential ] [ view full article ]
"Jason Danner" - Foreclosure/Loss Mitigation - #1 Real Estate Opp - ***** Freedom Foreclosure Prevention Services ****** Get in on the Ground-Floor of this rapidly growing and well-hidden market, ...
[ 06 Jul 2004 12:29:22 GMT ] [ 3697 ] [ realtynet.residential ] [ view full article ]
michele602@aol.comnospam (Michele) - 4-Plex 4-Sale Apache Junction, AZ - INCOME Property for sale - 4-Plex 4-Sale Apache Junction, AZ - INCOME Property for sale $225,000 - full inspection report available on request For pics and more info: www.michelesplace.com/fourplex 4-Plex 4-Sale - Apache Junction, AZ $225,000 www.michelesplace.com/fourplex . ...
[ 4 Jul 2004 15:06:12 -0700 ] [ 3695 ] [ realtynet.residential ] [ view full article ]
katieolsen@reeceandnichols.com (www.househuntingkc.com) - www.househuntingkc.com - Kansas City Real Estate Search - To search Kansas City Real Estate visit: http://www.househuntingkc.com . ...
[ Sun, 04 Jul 2004 00:34:56 GMT ] [ 3693 ] [ realtynet.residential ] [ view full article ]
mdavis@wp.shawcable.net - Mum Undressing 4592 - Hi, im 17 years old and was kinda freaked out when i caught my mum nude on my webcam. Posted the pics anyway haha. Enjoy! eqikrqrouuenvyzepwtmiwlvglfmzoycsxnwdlttwhfsgstrwpsfgwcyskycidnsrguhdxdkydmljpoizfihjptf ...
[ 1 Jul 2004 20:38:03 -0700 ] [ 3688 ] [ realtynet.residential ] [ view full article ]
sales@silversouthflorida.com (Sales) - Re: South Florida Property For Sale - If you would like further information, then please contact us. We can assist if you need help with South Florida property - buying or selling. We are also knowledgeable about new proprties from Fort Lauderdale to Miami. You can email us at southfloridasales@silversouthflorida.com. Thanks http://www.silversouthflorida.com . ...
[ 30 Jun 2004 22:45:39 -0700 ] [ 3687 ] [ realtynet.residential ] [ view full article ]
sales@silversouthflorida.com (Sales) - South Florida Property For Sale - Looking for great property on South Beach - South of Fifth -then check out the Cosmopolitan Towers. Or if you like Surfside - check out the Surfside Palms. See the following site for details: http://www.silversouthflorida.com. Thanks. . ...
[ 30 Jun 2004 09:46:48 -0700 ] [ 3686 ] [ realtynet.residential ] [ view full article ]
info@agenthunt.com (Kristofer) - How to find a real estate agent - Finding a real estate agent is easy. Finding a good real estate agent is more difficult. There are many questions that should be asked before hiring an agent to help you with what could be your biggest investment. Most people either don't ask any questions or don't know the right questions to ask. Following is a sample question that should be asked when interviewing a real estate age...
prev page  [1] [2] [3] [4] [5] [6] [7] [8] [9] [10] [11] [12] [13]  next page



[ USA -> CHICAGO - 11/October/2008 19:43:35 ] We have 18252 properties listed. Yesterday traffic on Estaplace Real Estate was: 1625 unique visitors with 76440 page views. To view more statistics about Estaplace Real Estate, click here.

We accept, payments through bank wire, western union, credit cards with PayPal, Bankpass and E-Gold! PayPal Gateway Bankpass Gateway Visa Card MasterCard American Express Diners Card Jcb Credit Card PostaPay Maestro Pago Bancomat Free thumbnail preview by Thumbshots.org

Giovanni Ceglia's Web Sites: Videogames & Programming, Programming Articles, Graphic Services, Job Search Services, Hotel & Accommodation Directory, Hosting Services, Identity Verification Services, Cheap Hosting & Domain Registration, The Complete Giovanni Ceglia's Network, Domains and Hosting Forums, Domains and Web sites for Sale, Cars and Vehicles for Sale.

Selected listings and actived platforms: - TurkStay Turkish Portal - Hardware and Software - Malmignatta Search Engine

Other related services and links:
mobile homes - new mobile homes for sale from $17,900, prices based on region.
Prosper Learning Stock Market - prosper learning will help your business prosper. learn the techniques that the experts use to master skills in real estate & stock investing.
hilton head south carolina - offers hilton head island vacation rentals and oceanfront accommodations.
-

RealEstateLinkExchange.com LinkRE.com - Real Estate Resources and Directory REALS - A Comprehensive Real Estate Directory RealEstateAward.com Real Estate 4 The Real Estate Portal Directory RealEstatePopular.com IRealEstateDirectory


Estaplace.com is a worldwide and international real estate directory, with thousands of real estate listings, divided into countries and regions. All material, the structure, and the layout on this site are © Copyright of Estaplace.com by Ceglia Giovanni located in Trento N. 74 Pal. I Street in Pagani(Salerno) - Italy. Italian Business Code: Partita IVA N. IT03972320653, registered in the "Camera di Commercio" of Salerno.

Estaplace.com is one the Ceglia Giovanni projects, started on 20 July 2005, and online since 20 August as a real estate platform for listings, mainly operating on the Italian and American/English market in the Internet, Estaplace would like to become the point of referiment for home sellers and home buyers, a site where private owners or real estate agencies can have the possibility to show their offers to the world. Estaplace.com is only one of the Giovanni Ceglia's sites. Everyday Giovanni Ceglia works to improve new Internet tools and services for online marketing and business. Estaplace.com will become the biggest portal for real estate business and investments online.