Home Page Properties For Sale Rentals Add your Listing All The Articles
Login Estaplace Contacts About Us House Exchange Real Estate Forum
ESTAPLACE.COM REAL ESTATE - FREE LISTING SERVICE - is an accommodation and real estate directory, where real estate property owners or real estate agencies connect with vacationers and home buyers worldwide. If you are a seller, you can add listings in few seconds, and if you are a buyer you can search listings to find your dream property!
Search by keywords or by a location.

You can also browse our web directory.

    back to the list and search form for newsgroup's messages


Nesgroup address: realtynet.residential - Date & Time for the message: Sun, 04 Jul 2004 00:34:56 GMT /

Author of the message: mdavis@wp.shawcable.net

Title of the message:
Mum Undressing 4592

Text of the message:
Hi, im 17 years old and was kinda freaked out when i caught my mum nude on my webcam. Posted the pics anyway haha.  Enjoy!
eqikrqrouuenvyzepwtmiwlvglfmzoycsxnwdlttwhfsgstrwpsfgwcyskycidnsrguhdxdkydmljpoizfihjptf



[ USA -> CHICAGO - 02/December/2008 15:38:29 ] We have 18524 properties listed. Yesterday traffic on Estaplace Real Estate was: 1871 unique visitors with 45412 page views. To view more statistics about Estaplace Real Estate, click here.

We accept, payments through bank wire, western union, credit cards with PayPal, Bankpass and E-Gold! PayPal Gateway Bankpass Gateway Visa Card MasterCard American Express Diners Card Jcb Credit Card PostaPay Maestro Pago Bancomat Free thumbnail preview by Thumbshots.org

Giovanni Ceglia's Web Sites: Videogames & Programming, Programming Articles, Graphic Services, Job Search Services, Hotel & Accommodation Directory, Hosting Services, Identity Verification Services, Cheap Hosting & Domain Registration, The Complete Giovanni Ceglia's Network, Domains and Hosting Forums, Domains and Web sites for Sale, Cars and Vehicles for Sale.

Selected listings and actived platforms: - TurkStay Turkish Portal - Hardware and Software - Malmignatta Search Engine

Other related services and links:
Mobile Homes - new mobile homes for sale from $17,900, prices based on region.
Prosper Learning Stock Market - prosper learning will help your business prosper. learn the techniques that the experts use to master skills in real estate & stock investing.
hilton head south carolina - offers hilton head island vacation rentals and oceanfront accommodations.
-

RealEstateLinkExchange.com LinkRE.com - Real Estate Resources and Directory REALS - A Comprehensive Real Estate Directory RealEstateAward.com Real Estate 4 The Real Estate Portal Directory RealEstatePopular.com IRealEstateDirectory


Estaplace.com is a worldwide and international real estate directory, with thousands of real estate listings, divided into countries and regions. All material, the structure, and the layout on this site are © Copyright of Estaplace.com by Ceglia Giovanni located in Trento N. 74 Pal. I Street in Pagani(Salerno) - Italy. Italian Business Code: Partita IVA N. IT03972320653, registered in the "Camera di Commercio" of Salerno.

Estaplace.com is one the Ceglia Giovanni projects, started on 20 July 2005, and online since 20 August as a real estate platform for listings, mainly operating on the Italian and American/English market in the Internet, Estaplace would like to become the point of referiment for home sellers and home buyers, a site where private owners or real estate agencies can have the possibility to show their offers to the world. Estaplace.com is only one of the Giovanni Ceglia's sites. Everyday Giovanni Ceglia works to improve new Internet tools and services for online marketing and business. Estaplace.com will become the biggest portal for real estate business and investments online.